Description
IGF LR3 (Long arginine 3-IGF-1) 1mg – High-Quality Research Peptide
dr peter thomas roth peptide cream Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: IGF LR3 1mg
- Catalogue Number: IGF1LR3-1mg
- Molecular Weight: 9117.60 gmol
- Purity: ≥98%
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Form: Lyophilised Solid
Usage and Storage:
Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
Grey-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.
If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research , explore our range of peptides designed for scientific rigour and innovation.dr peter thomas roth peptide cream
Reviews
There are no reviews yet.